Scaffold Ga0136549_10165921

Overview

Basic Information

• Taxon OID: 3300010389
• Scaffold ID: Ga0136549_10165921
• Source Dataset Name: Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 982
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment → Marine Sediment Microbial Communities From Methane Seeps Within Hudson Canyon, Us Atlantic Margin

Source Dataset Sampling Location

• Location Name: Baltimore Canyon, US Atlantic Margin
• Coordinates
  • Lat. (^o): 38.05018333
  • Long. (^o): -73.82193333
  • Depth (m): .12 to .14

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026284	Metagenome / Metatranscriptome	198	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136549_101659211	F026284	N/A	MRRKLNPQTSEYVQNGELICFGISEHVLEEQLPNWSPQAQNDLAILRSWFPRGNMEEVTRPVYRSDFNWTNYASRAQLRCALGLAVIRELPIKSFYARCVLAYGYIVYFIIRGVGRGLKHNRPIVMYNHSMNAKALANYPDLFYWSVTRVLPTSPPQPDAHREWRTRQNPVYHQYHKNVYRYRFRKSRYVQWDGTQNQPVMPFLHDHGTEVSNGTFKRNCNTGPQLK*