Scaffold Ga0136547_102757

Overview

Basic Information

• Taxon OID: 3300010381
• Scaffold ID: Ga0136547_102757
• Source Dataset Name: Methanogenic microbial communities from bioreactors in Yantai Institute of Oceanology, CAS, Yantai, China ? reactor 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Novogene Bioinformatics Technology Co., Ltd
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2155
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Bioreactor → Methanogenic Microbial Communities From Bioreactors In Yantai Institute Of Oceanology, Cas, Yantai, China

Source Dataset Sampling Location

• Location Name: Yantai academy of sciences oceanology institute, Yantai, China
• Coordinates
  • Lat. (^o): 37.0
  • Long. (^o): 121.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064893	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136547_1027573	F064893	N/A	VRDHQGMSKLVRYEFMGSWLLFWALAITVIGIPLAILYLISGLLRIEHEMADPERFIAEFRARRG*