Basic Information | |
---|---|
Taxon OID | 3300010371 Open in IMG/M |
Scaffold ID | Ga0134125_12203068 Open in IMG/M |
Source Dataset Name | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 599 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil → Terrestrial Soil Microbial Communities With And Without Nitrogen Fertilizer From Kellogg Biological Station, Michigan, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Kellog Biological Station, Michigan | |||||||
Coordinates | Lat. (o) | 42.3938 | Long. (o) | -85.3708 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F055012 | Metagenome / Metatranscriptome | 139 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134125_122030681 | F055012 | N/A | YTNPGNNNPGGAVQRLQIYLDKNWKINTGAAAKCSDSQLQNKTMAQAMSACSAALVGSGTAAVTANGLYQINGCVLLFNGRPATSGPDAGLPTLKVFMRLKVSNPSTIGCGYPSTNNQGNATVALNGVLRSATSPYGKVLAVKNITQLASYPLLEFKTKIGKSTSTYIQAKCPTTPWHMKVTWTYNDNTSKTVSKTQPC |
⦗Top⦘ |