Scaffold Ga0129336_10555118

Overview

Basic Information

• Taxon OID: 3300010370
• Scaffold ID: Ga0129336_10555118
• Source Dataset Name: Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 615
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location

• Location Name: USA: Chesapeake Bay
• Coordinates
  • Lat. (^o): 39.2637
  • Long. (^o): -76.0017

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078429	Metagenome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129336_105551182	F078429	N/A	CIGYLIVTDQSIAKAVVFVTQIAKNKFQVFKWWFIHNPQTPWARYSMHRRSMKLAEELMKELENK*