Scaffold Ga0116251_10002548

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116251_10002548

Scaffold Ga0116251_10002548

Overview

Basic Information
Taxon OID	3300010365 Open in IMG/M
Scaffold ID	Ga0116251_10002548 Open in IMG/M
Source Dataset Name	AD_USDIca
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	30499
Total Scaffold Genes	28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	20 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location Name	USA, Massachusetts, Boston
Coordinates	Lat. (^o)	42.35	Long. (^o)	-70.96	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023605	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116251_100025481	F023605	N/A	DYLQIKRWHSLYNEFGMASTVRDIILFFYNGVMKYGLEGFLELVGKKLRVDKLEKDFLDKMTQLLNITAQKRLLYELVIENYPQYVYST*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.