Scaffold Ga0116238_10432754

Overview

Basic Information

• Taxon OID: 3300010347
• Scaffold ID: Ga0116238_10432754
• Source Dataset Name: AD_JPHGca
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 847
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Japan
• Coordinates
  • Lat. (^o): 34.72
  • Long. (^o): 135.27

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103319	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0116238_104327542	F103319	GGAGG	MADQYNSIGHHPKSTYMTSEGHALHNISGLDLIIDIAGVYFPLRSINYAANHNVTDEHGTGTHDPVALTNQEHTYSGTFTYASFLVTGENVLTQKDVLTLTQLLQDQADEGVSKYFDIYIIEVQGKRTPGAGTTFEEQVEAALQNESMVGYIEALVDCKVTKVNRDIPEKNTVVSSREFKYSYKLPR*