Scaffold Ga0116243_10002397

Overview

Basic Information

• Taxon OID: 3300010344
• Scaffold ID: Ga0116243_10002397
• Source Dataset Name: AD_JPASca
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 35259
• Total Scaffold Genes: 28
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 19 (67.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin133 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: Japan
• Coordinates
  • Lat. (^o): 43.77
  • Long. (^o): 142.37

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023605	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116243_1000239728	F023605	N/A	VDGKRLDKYLRISEADYLQIKRWHSLYNEFGMASTVRDIILFFYNGVMKYGLEGFLEIVGKKLRIDKLKNDFLGKMTQLLDIAARKRLLYELLIENYPQYVYYT*