Scaffold Ga0074045_10712483

Overview

Basic Information

• Taxon OID: 3300010341
• Scaffold ID: Ga0074045_10712483
• Source Dataset Name: Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 637
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Schlesneria → Schlesneria paludicola (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location

• Location Name: Calvert Island, British Columbia, Canada
• Coordinates
  • Lat. (^o): 51.62
  • Long. (^o): -128.09

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005959	Metagenome / Metatranscriptome	385	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074045_107124833	F005959	N/A	MIDLKLEVPITEEVEVDAKTLAAIDRGIADADAGRVVPLDEVRKLVPQWISKFESPKPR*