NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116250_10092167

Scaffold Ga0116250_10092167


Overview

Basic Information
Taxon OID3300010340 Open in IMG/M
Scaffold IDGa0116250_10092167 Open in IMG/M
Source Dataset NameAD_USOAca
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2015
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)37.8Long. (o)-122.27Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016798Metagenome / Metatranscriptome244Y
F068738Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0116250_100921671F016798N/AMFTKNIYMKKFILILLLLVLVSCKKEFKELQRSYVISNFIDLNDDLDYKLIYFCDKYNAFEHFYDIKHTIYNEIGEHNYYKDMQTRMGIVSYTKDTGTCQFQNSTFYYLANKYNLNNANILNENHQIAIMVQAFRDGKKNWWCGYKKYKKSIE*
Ga0116250_100921673F068738N/ANLINRYKNDIKSYNIKIDSLNAVLLAKKKIDTVIITKYKQKIDSVYVYNYNDYVVFYDTLLNTNLANVDTFICFDSISIQKLSIKLLECGKDSELLANCYLQNNIYSNIIAVQDSVIILKDSVIEILDDINKEKIKKLRRQRNTFAGATFVEFLVILGLISK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.