NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074046_10000682

Scaffold Ga0074046_10000682


Overview

Basic Information
Taxon OID3300010339 Open in IMG/M
Scaffold IDGa0074046_10000682 Open in IMG/M
Source Dataset NameBog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)31112
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (57.69%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location
Location NameCalvert Island, British Columbia, Canada
CoordinatesLat. (o)51.62Long. (o)-128.09Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000525Metagenome / Metatranscriptome1049Y
F002927Metagenome / Metatranscriptome520Y
F003855Metagenome / Metatranscriptome465Y
F008957Metagenome / Metatranscriptome325Y

Sequences

Protein IDFamilyRBSSequence
Ga0074046_1000068215F002927N/AMGPESGKRGGFSLRGSAALVVAVGVVAILLIALPAYRWFFLFSVLVGLVIAGGLALWHRLRPISEKDVEHKRPLGL*
Ga0074046_1000068219F008957AGGAGMTEAVRHDGPEEPKKSGWWWPAGVLASSVAGAAALVAFRGCWHSKMSWPVGVQGCSYQVCLSCGAMRLFDEKTFSAYGPFRNDLDQLRAWRKSKA*
Ga0074046_1000068223F000525GAGMGISPSPAKILSQPFIKLMQPAKTLLLAILLSVGLACSPRDFLTRRLAADLIVASDAFKAPQIFWLRTGIVSNKDFSSPDSLVLQRRGWIIGTEQKKCPAGIDPPPCWDVQLSPLGVDTIRPLITSTLTPPVPATETDIGPIGMQVARRELVNISGISKAGNFADVEFIWRWVSINQVGAALYDSGVHYRSTVGFRGYDDGWRVVEQSIPSNQPLDEALRNAQPASP*
Ga0074046_100006827F003855GGAGMRAEIYLNAALSHDLAEPLSCTQKETLQRAVTKIVALGEQVGVSADQMAELLQAGLTVGELLQYLTERSGEVS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.