Scaffold Ga0134071_10010466

Overview

Basic Information

• Taxon OID: 3300010336
• Scaffold ID: Ga0134071_10010466
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3709
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Angelo Coastal Reserve, California
• Coordinates
  • Lat. (^o): 39.7181
  • Long. (^o): -123.6527
  • Depth (m): .4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030720	Metagenome / Metatranscriptome	184	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134071_100104661	F030720	N/A	MAGMRAISAGGRALVVTGAALLLGSLFVLPWFAVSGTRTDLPAGTYGGMGSTELVNSLLGGPWGWIAFLWLVVAAFLGIGIAAVGRKTRRIGTSGIVVLLLYVVLLVVAPPYLNPQASSGTVSVSFGYGFVAGVLGSALIEA