Scaffold Ga0136651_10362460

Overview

Basic Information

• Taxon OID: 3300010330
• Scaffold ID: Ga0136651_10362460
• Source Dataset Name: Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 715
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Mexico: Guaymas Basin, Gulf of California
• Coordinates
  • Lat. (^o): 27.0078
  • Long. (^o): -111.4071
  • Depth (m): 2000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040420	Metagenome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136651_103624602	F040420	N/A	MNRFIIIGLMLTISLTQFLALDSIDSHSYIDGTYVCRDFSRDLILSASKYHIYLDYIYVPEKNHMMVGLYNPLENSIEIIEPQTDEIIGCVKEDDKNYIRIPVWNSCFYYSNVK