Scaffold Ga0129297_10004741

Overview

Basic Information

• Taxon OID: 3300010324
• Scaffold ID: Ga0129297_10004741
• Source Dataset Name: Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6843
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Indonesia: Gulf of Boni
• Coordinates
  • Lat. (^o): -2.75
  • Long. (^o): 121.05

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087392	Metagenome / Metatranscriptome	110	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0129297_100047413	F087392	N/A	MDPNDKSKTTTFRRIEMAKLFKVLANVTACILFLGGVMGIISRMYVWFAVTGFNGTGTDMAQLALQFVYIAIWFVAAVVVMKLSQMLK*