Scaffold Ga0136653_10064424

Overview

Basic Information

• Taxon OID: 3300010319
• Scaffold ID: Ga0136653_10064424
• Source Dataset Name: Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1817
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Rwanda: Lake Kivu
• Coordinates
  • Lat. (^o): -2.0288
  • Long. (^o): 29.1756
  • Depth (m): 220

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040697	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136653_100644243	F040697	AGG	MKLNKIIQNEEPIDSILKEAAEGYGDLIAAALNHRVSVKSLQARVIELRDLKVAWIS*