NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126331_1261528

Scaffold Ga0126331_1261528


Overview

Basic Information
Taxon OID3300010314 Open in IMG/M
Scaffold IDGa0126331_1261528 Open in IMG/M
Source Dataset NameMarine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-98 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)717
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameHawaii, USA
CoordinatesLat. (o)21.3935Long. (o)-157.7156Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000418Metagenome1160Y

Sequences

Protein IDFamilyRBSSequence
Ga0126331_12615282F000418N/ALDFTEARDSEWQWHQLGHMQVCTSLQTDNRSVFYTGRMPFHPPNQQRQSTGGTI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.