Scaffold Ga0116211_1211740

Overview

Basic Information

• Taxon OID: 3300010313
• Scaffold ID: Ga0116211_1211740
• Source Dataset Name: Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Sagole hot spring metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 502
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: South Africa: Limpopo
• Coordinates
  • Lat. (^o): -22.5304
  • Long. (^o): 30.6814
  • Depth (m): 1.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024422	Metagenome / Metatranscriptome	206	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116211_12117401	F024422	GGCGG	MSLDYQKGAWPAWNLEPENGVPVPCALGQPWVNEDTQITLEKLRIPRTDPWGKPLPGEPEDPVLARLRRDPAD*