Scaffold Ga0136652_1018830

Overview

Basic Information

• Taxon OID: 3300010308
• Scaffold ID: Ga0136652_1018830
• Source Dataset Name: Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer E metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1594
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.4127
  • Long. (^o): -118.504

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094058	Metagenome / Metatranscriptome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0136652_10188303	F094058	GGAGG	MGKLGQIIANLILYGFLVWLLYDALVVEHDPWFAFCVGFVIAVAILVQLMPGLHARALSPGRFPDAESHG*