Scaffold Ga0126325_10174323

Overview

Basic Information

• Taxon OID: 3300010298
• Scaffold ID: Ga0126325_10174323
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 1 OAHU.JWI-14 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1114
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Hawaii, USA
• Coordinates
  • Lat. (^o): 21.2608
  • Long. (^o): -157.7866
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005770	Metagenome	390	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126325_101743231	F005770	N/A	GGRETPITEFVMISRHEQLPHVIGIGPQWATTNVQQKATVVSDVRGSQSNKRLMYEPRDLEHNALTDC*