Scaffold Ga0129348_1017670

Overview

Basic Information

• Taxon OID: 3300010296
• Scaffold ID: Ga0129348_1017670
• Source Dataset Name: Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2597
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location

• Location Name: USA: Chesapeake Bay
• Coordinates
  • Lat. (^o): 37.0306
  • Long. (^o): -76.0464

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003687	Metagenome / Metatranscriptome	473	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129348_10176704	F003687	AGGA	MSPSSVEHLLTQKIRLLARRESPVIDQELENLRQAALEIFFQWQDGLVQFQDLTPFVAILEKKVDLNRSLLKWEQQHITD*