Scaffold Ga0116204_1097377

Overview

Basic Information

• Taxon OID: 3300010293
• Scaffold ID: Ga0116204_1097377
• Source Dataset Name: Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1024
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Rwanda: Lake Kivu
• Coordinates
  • Lat. (^o): -1.78
  • Long. (^o): 29.2
  • Depth (m): 52

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011752	Metagenome / Metatranscriptome	287	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116204_10973772	F011752	N/A	MNATTEDIVAHVRTWSLDRAADMSIPKEDARAILAEFYEWIEPETDELEIVSLEPQD*