Scaffold Ga0129299_1117074

Overview

Basic Information

• Taxon OID: 3300010289
• Scaffold ID: Ga0129299_1117074
• Source Dataset Name: Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer C metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 829
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 37.4127
  • Long. (^o): -118.504

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077115	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129299_11170741	F077115	GAG	MASPGPRDAVRGTLCAVRDLLLFWRPPAGKTAAEYLGGRWEWGWTLFVWTNEASVGAAWSRLVEARGYVPQRLDRRAFASFLASAEDIRGLLLDGELEGDGDVIR