Scaffold Ga0116210_1001737

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116210_1001737

Scaffold Ga0116210_1001737

Overview

Basic Information
Taxon OID	3300010288 Open in IMG/M
Scaffold ID	Ga0116210_1001737 Open in IMG/M
Source Dataset Name	Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Tshipise hot spring metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	15131
Total Scaffold Genes	21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	21 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	South Africa: Tshipise
Coordinates	Lat. (^o)	-22.6092	Long. (^o)	30.1749	Alt. (m)		Depth (m)	2 to 3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041729	Metagenome	159	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116210_10017373	F041729	GGAGG	MSAKTFEGSVSIVKNTKGEIALKRDPEGRFSAANAAECYAKMMELCKRLKSPVNKYSLFIADGGTEPVMLANRFGNPYIALLPKRGDGNVKRSAVTKLA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.