Basic Information | |
---|---|
Taxon OID | 3300010235 Open in IMG/M |
Scaffold ID | Ga0136247_10006486 Open in IMG/M |
Source Dataset Name | Terrestrial oil reservoir microbial community from Schrader Bluff Formation, Alaska - SB2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Yale Center for Genome Analysis |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2913 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Produced Fluid → Terrestrial Oil Reservoir Microbial Communities From Alaska |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Alaska, USA | |||||||
Coordinates | Lat. (o) | 70.4 | Long. (o) | -148.7 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025288 | Metagenome / Metatranscriptome | 202 | N |
F031475 | Metagenome / Metatranscriptome | 182 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136247_100064863 | F025288 | N/A | MKNKWIWITLMVIVIFGLIAGAGALGYQVGLRSANALAPQTDEDRALPRQLMPWLRNAPDGGIIRRPTGFIGYFFLFPLGLLLRLAILVLVVWLVVKVAKAAWNGGNHKSKPAEAVITQTPEKTPEAMVSAAPPEETAPPSEAPQGGEK* |
Ga0136247_100064864 | F031475 | GGA | MGANTSDSSQDSLNANPQKQREKLTQLDFLTLEMMGTSLEELRELLDEEELQAYFAFLRRQSSDLDSTSP* |
⦗Top⦘ |