Basic Information | |
---|---|
Taxon OID | 3300010233 Open in IMG/M |
Scaffold ID | Ga0136235_1016928 Open in IMG/M |
Source Dataset Name | Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA. |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Fidelity Systems Inc |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1719 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Filterable Freshwater Microbial Communities From Conwy River, North Wales, Uk |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Conwy River, Conwy, North Wales, UK | |||||||
Coordinates | Lat. (o) | 53.2 | Long. (o) | -3.82 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067348 | Metagenome / Metatranscriptome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136235_10169282 | F067348 | AGGAG | MADPTFDQISATTLADLREDVVVDNFFVETAGQRYMREKAILDEFEGGTLMQTVFQYDRVNGGAVFPGSDVNVIQKQIFAATAFGPKEYVEQIPLNEFQTQVINAGPNARVKIEDGYMQNAVQSLNTDL* |
⦗Top⦘ |