Scaffold Ga0136219_1001759

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136219_1001759

Scaffold Ga0136219_1001759

Overview

Basic Information
Taxon OID	3300010227 Open in IMG/M
Scaffold ID	Ga0136219_1001759 Open in IMG/M
Source Dataset Name	Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Fidelity Systems Inc
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2767
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil

Source Dataset Sampling Location
Location Name	Bangor area, North Wales, UK
Coordinates	Lat. (^o)	53.24	Long. (^o)	-4.01	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033476	Metagenome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136219_10017595	F033476	AGGAG	MHPYRLFAHDGLGNFNLIQEFSAQNDEAAGKFVARWSARPLELWQSSRKVKCWPTQDLNSLSVET*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.