Scaffold Ga0136219_1000829

Overview

Basic Information

• Taxon OID: 3300010227
• Scaffold ID: Ga0136219_1000829
• Source Dataset Name: Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Fidelity Systems Inc
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4241
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil

Source Dataset Sampling Location

• Location Name: Bangor area, North Wales, UK
• Coordinates
  • Lat. (^o): 53.24
  • Long. (^o): -4.01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048506	Metagenome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136219_10008297	F048506	N/A	XXXXTPQRQIFRLRLGQHRVETTPLPDDVWPSYQDVLISPDGRFVAYVAEDSTPANPGTYAVVRDIKSGRMVVRGPGGGGCDCDEDFNHARWFPPDSFEIAVAHRNTTGTWERFSGKASVARVHVDTLTDEPDWH*