Scaffold Ga0124924_1067055

Overview

Basic Information

• Taxon OID: 3300010193
• Scaffold ID: Ga0124924_1067055
• Source Dataset Name: Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_T MetaT (Metagenome Metatranscriptome) (version 2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 609
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location

• Location Name: USA: Wyoming: Yellowstone National Park
• Coordinates
  • Lat. (^o): 44.539
  • Long. (^o): -110.798

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009196	Metagenome / Metatranscriptome	321	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0124924_10670551	F009196	N/A	RCCLAAQLAIHGWLVEMMEGASGGQRRQVRQVLRRAGQEDAGNRPVAPFVNLPPEVWPDFRRLREIETALAAGQMPPPPDAGAENRSASRAVLTRLPEAPPRINPPGNTDRAAGAEPPVRHPFPETIRHE*