Scaffold Ga0136175_10030176

Overview

Basic Information

• Taxon OID: 3300010163
• Scaffold ID: Ga0136175_10030176
• Source Dataset Name: Cecal microbial community of the 13 lined ground squirrel in Duluth, Minnesota, USA. Combined Assembly of 10 SPs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Minnesota - Twin Cities
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8185
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Cecum → Ictidomys Tridecemlineatus Cecum → Ictidomys Tridecemlineatus (13 Lined Ground Squirrel) Cecal Microbiome

Source Dataset Sampling Location

• Location Name: Duluth, Minnesota, USA
• Coordinates
  • Lat. (^o): 46.7867
  • Long. (^o): -92.100487

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093041	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136175_100301761	F093041	N/A	MLGTHNDYMMAKRHKAFRRAALLLSRTAMLFCHIFIAMSIAQMILSIICCQTCRLA