NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136175_10000426

Scaffold Ga0136175_10000426


Overview

Basic Information
Taxon OID3300010163 Open in IMG/M
Scaffold IDGa0136175_10000426 Open in IMG/M
Source Dataset NameCecal microbial community of the 13 lined ground squirrel in Duluth, Minnesota, USA. Combined Assembly of 10 SPs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Minnesota - Twin Cities
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)107710
Total Scaffold Genes116 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)81 (69.83%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Cecum → Ictidomys Tridecemlineatus Cecum → Ictidomys Tridecemlineatus (13 Lined Ground Squirrel) Cecal Microbiome

Source Dataset Sampling Location
Location NameDuluth, Minnesota, USA
CoordinatesLat. (o)46.7867Long. (o)-92.100487Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013656Metagenome269Y

Sequences

Protein IDFamilyRBSSequence
Ga0136175_1000042644F013656GAGGMAKSYKEPIESEVETTINVIYSENILSVYTNKAALQKSLCKTLGKPTQEYRKGRSILASRWDISLDEKIKISQMMLKSDIFNLN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.