Scaffold Ga0114960_10003492

Overview

Basic Information

• Taxon OID: 3300010158
• Scaffold ID: Ga0114960_10003492
• Source Dataset Name: Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 12013
• Total Scaffold Genes: 20
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 15 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Croche, Canada
• Coordinates
  • Lat. (^o): 46.8319
  • Long. (^o): -72.5
  • Depth (m): 3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070853	Metagenome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114960_1000349213	F070853	GAG	MTWWGRVDSNGKRCMMPIHHGMRVDCETMKPTKPITIIGKKVDRKVGKTLLAQYQDFYKTTEVMTKAMDYEVFVRTTVEVVKEYFGEDVSQTAWHWQTCKQKADAIVDSAPLDAAILYIMGWDIGSMRWNLRRFMDTQYGRYSAHEDTPHDMFLNLKRRLNKEIYKANSQVFKSVEYSSGEVYPPSEWGYTIIVDGVEVKQYD*