NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068873_1015485

Scaffold Ga0068873_1015485


Overview

Basic Information
Taxon OID3300010156 Open in IMG/M
Scaffold IDGa0068873_1015485 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)760
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004115Metagenome / Metatranscriptome452Y
F017667Metagenome / Metatranscriptome239Y

Sequences

Protein IDFamilyRBSSequence
Ga0068873_10154851F004115N/ALDTPLYWVDYDFQHQKIGTTLSLTRNHNTNQYCDYCKYRWGANKNGWDLRAMTPAVWKVQSETPLRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISNFAGREKLNVELP*
Ga0068873_10154852F017667GAGMSNYLDDYVSVQDRLKEFINAYPDYRIKTHILAESLVANCDVYIIKTELYRTEADAHPWTTGLSSESKSKQYALELAETGSLGRALNLAGYFAKTKQSPKKAIETTKPALAEFIKEQRPNDPEPIVWDVSAIANQLGAEIVDE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.