Scaffold Ga0127503_11182386

Overview

Basic Information

• Taxon OID: 3300010154
• Scaffold ID: Ga0127503_11182386
• Source Dataset Name: Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3625
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates

Source Dataset Sampling Location

• Location Name: USA: Willow Creek, Wisconsin
• Coordinates
  • Lat. (^o): 45.8056
  • Long. (^o): -90.0794
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053203	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127503_111823863	F053203	GAG	MVNIAEIELAPDVVWIGVHPGQLCRSAEQVNARLDQVRQSGRSYSPEVLAEHDGVVLFDPHVDPPAEIPELHQIAIVHGNLVQEIRDYPDRAAATAAFEAIW*