Scaffold Ga0098059_1022382

Overview

Basic Information

• Taxon OID: 3300010153
• Scaffold ID: Ga0098059_1022382
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2584
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → Phycisphaeraceae → Phycisphaera → unclassified Phycisphaera → Phycisphaera sp. TMED151 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Subarctic Pacific Ocean
• Coordinates
  • Lat. (^o): -16.21
  • Long. (^o): -76.63
  • Depth (m): 55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059457	Metagenome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0098059_10223825	F059457	GGAG	MQATKIGNTELYTARVLNMSVAQYYGVVKEYNELVVETRELNKKELEKNGDKAELNLYYSVRYNLNKLVLEKINGENNE*