Scaffold Ga0126318_10154733

Overview

Basic Information

• Taxon OID: 3300010152
• Scaffold ID: Ga0126318_10154733
• Source Dataset Name: Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1093
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates

Source Dataset Sampling Location

• Location Name: Southern Great Plains ARM Site, Oklahoma
• Coordinates
  • Lat. (^o): 36.605
  • Long. (^o): -97.485
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022918	Metagenome / Metatranscriptome	212	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126318_101547332	F022918	AGGAGG	LTKSRLIYLLLIASLFAYTLACFRISLPGIGTSGMSDGGGLL*