NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0098049_1002283

Scaffold Ga0098049_1002283


Overview

Basic Information
Taxon OID3300010149 Open in IMG/M
Scaffold IDGa0098049_1002283 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7312
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameSubarctic Pacific Ocean
CoordinatesLat. (o)-14.509Long. (o)-76.198Alt. (m)Depth (m)48
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008563Metagenome / Metatranscriptome331Y
F010105Metagenome / Metatranscriptome308Y
F100883Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0098049_100228310F100883AGAAGGMNFHNIIFKRRDGIGLGGFKSRTHFTNGLSLSVSAGEGIYCSPREDRSSINQYLTFEIAVFDADDNFITKTFFPDHNDDVVGWLSRDEINDLMNRIANHGKPQKDIPGFEGTLDQLNKLKI*
Ga0098049_100228312F008563N/AMTKKFKIESHMGIAFSTIGGQKYLFPGWIPVEDHISFDDVEVINPYRNIKRETFEVLGSTGNKYTVTKNGNRLSCDCPAGKFRGTCKHSKKIAAELKLS*
Ga0098049_100228314F010105N/AMDTIKKMVLDYAEKKGKSKWKELQSLIVKHKDLDPNDRSNRGYFSSYFSGGSDFMKRRGYDPNKGKHGRGSNSHGLLMRPTKKDPRYLEKDGKDYIVKVWDGKSKLS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.