Scaffold Ga0127485_1058859

Overview

Basic Information

• Taxon OID: 3300010091
• Scaffold ID: Ga0127485_1058859
• Source Dataset Name: Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_1 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 672
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location

• Location Name: USA: Angelo Coastal Reserve, California
• Coordinates
  • Lat. (^o): 39.7181
  • Long. (^o): -123.6527
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096733	Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127485_10588591	F096733	N/A	SVVGTDQSVEAPSGVSDSHQGCSTGTSPSRGRPSRGFACLSKRSGPRSGVIGSPHPPRRLHDREVFRNPAVRAVRRPPGCFHRLRRPLRVRALVPSPTVPGRIAPPGVSRPSGDMSRRDPVHPGLPHPAPSVLGVSRPLDGLLSLRPCGLAGSAAASGVHSRGALSDGEAETRFRICCAPSPTVLISLEL*