Scaffold Ga0126309_10905765

Overview

Basic Information

• Taxon OID: 3300010039
• Scaffold ID: Ga0126309_10905765
• Source Dataset Name: Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 585
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil → Serpentine Soil Microbial Communities From Uc Mclaughlin Reserve, Ca, Usa

Source Dataset Sampling Location

• Location Name: UC McLaughlin Reserve (Lake County, CA)
• Coordinates
  • Lat. (^o): 38.8707
  • Long. (^o): -122.4274

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014785	Metagenome / Metatranscriptome	260	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126309_109057651	F014785	GGAGG	VAKLHCPCGQGEDLWGEFWWVEGRYRWLFFDYDQRSETFGEQVERCPACGRLLERKDLSAPRL*