Scaffold Ga0126338_10067599

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0126338_10067599

Scaffold Ga0126338_10067599

Overview

Basic Information
Taxon OID	3300010030 Open in IMG/M
Scaffold ID	Ga0126338_10067599 Open in IMG/M
Source Dataset Name	Coral microbial communities from Petempiche,Puerto Morelos, Mexico - Orbicella C C metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1842
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location Name	Petempiche,Puerto Morelos, Mexico
Coordinates	Lat. (^o)	20.9047	Long. (^o)	-86.8366	Alt. (m)		Depth (m)	8
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104456	Metagenome / Metatranscriptome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126338_100675992	F104456	N/A	LKASFFSRKSLKLLETESLAEVQFVIDICRFVSQSNYLNNSNKDCDWLILACFIGEQYTADATFARLENKVWFENLAKCVGKLSDSLS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.