Scaffold Ga0133736_1456908

Overview

Basic Information

• Taxon OID: 3300009966
• Scaffold ID: Ga0133736_1456908
• Source Dataset Name: Termite gut microbial communities. Combined Assembly of Gp0151149, Gp0151152, Gp0151222, Gp0151223
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Luxembourg, Luxembourg Institute of Science and Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 503
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study

Source Dataset Sampling Location

• Location Name: France
• Coordinates
  • Lat. (^o): 48.913957
  • Long. (^o): 2.485499

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011413	Metagenome	291	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133736_14569081	F011413	N/A	ALTKRSQGRPKYRWEDNIKQDICQMKIKNWIACVQDRGKWKEVVEKAKTFN*