NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0133736_1432164

Scaffold Ga0133736_1432164


Overview

Basic Information
Taxon OID3300009966 Open in IMG/M
Scaffold IDGa0133736_1432164 Open in IMG/M
Source Dataset NameTermite gut microbial communities. Combined Assembly of Gp0151149, Gp0151152, Gp0151222, Gp0151223
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Luxembourg, Luxembourg Institute of Science and Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)540
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study

Source Dataset Sampling Location
Location NameFrance
CoordinatesLat. (o)48.913957Long. (o)2.485499Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000429Metagenome1149Y

Sequences

Protein IDFamilyRBSSequence
Ga0133736_14321641F000429N/AEGKAVPLQAWSGPEGSRKLRFPDFMTTAQDGGKVVSLTHRPPLPPGNTPGTHFC*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.