Scaffold Ga0131849_103031

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0131849_103031

Scaffold Ga0131849_103031

Overview

Basic Information
Taxon OID	3300009947 Open in IMG/M
Scaffold ID	Ga0131849_103031 Open in IMG/M
Source Dataset Name	Compost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 67 mira
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Center for Advanced Technologies in Genomics, Sao Paulo University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1857
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Source Dataset Sampling Location
Location Name	Sao Paulo Zoo, Brazil
Coordinates	Lat. (^o)	-23.651072	Long. (^o)	-46.620675	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059782	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0131849_1030312	F059782	GAG	VLGSDXVRVEFETARGRVIPGTGGQVATFFVALEIWSEQLTGPERAELTHRLSTRIMEAIAEEFGGEEIEIRRLRE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.