Scaffold Ga0131849_100713

Overview

Basic Information

• Taxon OID: 3300009947
• Scaffold ID: Ga0131849_100713
• Source Dataset Name: Compost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 67 mira
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Center for Advanced Technologies in Genomics, Sao Paulo University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4114
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (88.89%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ZCTH02-B6 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Source Dataset Sampling Location

• Location Name: Sao Paulo Zoo, Brazil
• Coordinates
  • Lat. (^o): -23.651072
  • Long. (^o): -46.620675

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059782	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0131849_1007136	F059782	GGAG	VRVEFETARGRVVPGKGSQVAAFFVALEVESEQLTVPERGELLQRLTTRIVDAIAEEFGGEEIEVRRRHD*