Scaffold Ga0117932_1120643

Overview

Basic Information

• Taxon OID: 3300009945
• Scaffold ID: Ga0117932_1120643
• Source Dataset Name: Combined Assembly of Gp0139326, Gp0139349, Gp0139350, Gp0139351
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Wisconsin, Madison
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1036
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Water Column → Stable Isotope Probing Incubations Of Microbial Communities From Chocolate Pots Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location

• Location Name: Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.71538
  • Long. (^o): -110.73627

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073072	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0117932_11206432	F073072	N/A	MQQRSEPKMTKTKKIVFIYAQLVEEPEAYGGKTNADIEKEILKDIGLIPYVARIEKVTVLDCPP*