Basic Information | |
---|---|
Taxon OID | 3300009924 Open in IMG/M |
Scaffold ID | Ga0131761_1044634 Open in IMG/M |
Source Dataset Name | Microbial communities of marine sponge Stylissa flabelliformis from Great Barrier Reef, Australia - S7 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of New South Wales |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 513 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Davies Reef, Great Barrier Reef, Australia | |||||||
Coordinates | Lat. (o) | -18.833 | Long. (o) | 147.683 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F017963 | Metagenome / Metatranscriptome | 237 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0131761_10446341 | F017963 | N/A | VGTGRAISVLFGINGVRNKRSHLVGPPFPEFKACFSATAGWHFSRDLTRRLLIGGCGQSRIC* |
⦗Top⦘ |