Scaffold Ga0131761_1000786

Overview

Basic Information

• Taxon OID: 3300009924
• Scaffold ID: Ga0131761_1000786
• Source Dataset Name: Microbial communities of marine sponge Stylissa flabelliformis from Great Barrier Reef, Australia - S7
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2015
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Porifera → Demospongiae → Heteroscleromorpha → Haplosclerida → Niphatidae → Amphimedon → Amphimedon queenslandica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World

Source Dataset Sampling Location

• Location Name: Davies Reef, Great Barrier Reef, Australia
• Coordinates
  • Lat. (^o): -18.833
  • Long. (^o): 147.683

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024258	Metagenome / Metatranscriptome	206	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0131761_10007862	F024258	AGG	MYKDLESTSNAAIISKEWQNAFACAIGTRLNLDLLCVAQNGIVLELRRIEASQNCHFCQFANKRAERGYYDESDIVLCVK*