Scaffold Ga0131755_117150

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0131755_117150

Scaffold Ga0131755_117150

Overview

Basic Information
Taxon OID	3300009900 Open in IMG/M
Scaffold ID	Ga0131755_117150 Open in IMG/M
Source Dataset Name	Microbial communities of marine sponge Stylissa flabelliformis from Great Barrier Reef, Australia - S15
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of New South Wales
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	550
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Sponge → Unclassified → Unclassified → Marine → Sponge Microbes In A High Co2 World

Source Dataset Sampling Location
Location Name	Davies Reef, Great Barrier Reef, Australia
Coordinates	Lat. (^o)	-18.833	Long. (^o)	147.683	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073151	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0131755_1171501	F073151	N/A	AQNAKFWHFSSYHHPKAVRASDLILGSWAHQAFCFTNPTFEAVDSIQSEVVAIGIKQPIFDHG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.