Scaffold Ga0131092_10120291

Overview

Basic Information

• Taxon OID: 3300009870
• Scaffold ID: Ga0131092_10120291
• Source Dataset Name: Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Novogene Bioinformatics Technology Co., Ltd
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3005
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Community Analysis In Wastewater Treatment Plant From Tai Wan

Source Dataset Sampling Location

• Location Name: Tai Wan
• Coordinates
  • Lat. (^o): 25.0
  • Long. (^o): 121.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047544	Metagenome / Metatranscriptome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0131092_101202912	F047544	GGAGG	MNKLAVVIAVAAAPFLLAATAAQGNLYGRFNDGVYLAPGKLFRLSSPFPDAPIVSDGRQPDNNNAGAVSFIDETGRMVGVLYMEDKDKTIAAGEDTRHLADWFRDTGFPRFFQANVPDSKVLRDEAGVIDGKPAWIAVAHVPNGAPLGVSVKGSYDVKRNDSWRGMAVVANGKHYYLLQTELRVEKLAAPDWKYDANAADWNAFVPELEALYGRIEFLKP*