Scaffold Ga0123355_10301096

Overview

Basic Information

• Taxon OID: 3300009826
• Scaffold ID: Ga0123355_10301096
• Source Dataset Name: Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2186
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location

• Location Name: Petit - Saut dam, French Guiana
• Coordinates
  • Lat. (^o): 5.0626
  • Long. (^o): -53.0462

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023639	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123355_103010961	F023639	GGAG	MSHRITTIALAGAVLSGLVFTPVAAAEREQVRAVINLMAAIKKPFPENLDRNVAHTEYVKLDGGGETVACIRVDDKTRWCYEHVPALGSRTEMLRIRNEPVEGLEVGQLFQYVVDYDLDGLTDVGSTTRMEQPAHAPVASVIQFFVRGTGRGDQFRSDYQKLYDDGIQVALKYL