Scaffold Ga0105062_1104993

Overview

Basic Information

• Taxon OID: 3300009817
• Scaffold ID: Ga0105062_1104993
• Source Dataset Name: Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 562
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. W3-3-2 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location

• Location Name: USA: Columbia River, Washington
• Coordinates
  • Lat. (^o): 46.372
  • Long. (^o): -119.272

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026166	Metagenome	199	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105062_11049931	F026166	N/A	MPPRPERPPDADYYERDRVELASQGDLFRDVPLAYPMPASELVIDEEEGRGSRHFLSGPLEFGPAMLITPSCSLAAQREAGYSHPVRTLVPVLPLEHLVGQGVIKETAVADFRRFDHLINYMYVPPLEVDELEFSMPESVALLYMPVTLHHAFLEGQRVSQLAYR