Scaffold Ga0105062_1038259

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105062_1038259

Scaffold Ga0105062_1038259

Overview

Basic Information
Taxon OID	3300009817 Open in IMG/M
Scaffold ID	Ga0105062_1038259 Open in IMG/M
Source Dataset Name	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	855
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location
Location Name	USA: Columbia River, Washington
Coordinates	Lat. (^o)	46.372	Long. (^o)	-119.272	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030914	Metagenome	184	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105062_10382592	F030914	N/A	HREEGLLHEGEALRVHYGLPEEALQFYHVHSDTNDEHGDINEAILKKYCVSHELQEKALDAARFRWENQETRHDIIYRYFVLGAS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.